GenomeNet

>bsu:BSU06590 no KO assigned | (RefSeq) yerD; glutamate synthase large subunit-like protein YerD (A)
METIIIALIAFIIGIIAIPIVLFAWIYIKDEKQQEHSILRNYPVIGRFRYILEKIGPELR
QYLYSNDNEEQPFSRKEYEQTVISGKYKSRMMGFGSVRDFDKPGYYIRNAMFPKQREEMH
VNQTPKIETQIYKMDADNLFKRKEHAEHIKADPYFLHPDDVQVIGEHTCEKPFYVKGLVG
QSAMSYGSLGERAVTALSKGLHLAGGTWMNTGEGGLSEYHLKGGADIICQIGPGLFGVRK
RNGEFSWEEFKRKSRIDQIKAFELKLAQGAKTRGGHVDGAKVSEEVADIRNVEPGKSIDS
PNRFYEFSNPPEMLDFIEKLRDVGQKPVGIKLVAGHPEELHELFSHMQKSGKHPDFITID
GSEGGTGASFYELADTVGLPIMTALPIVDTLLKQYGLRSQLKIFASGKLLTPDKIAVALA
LGADFVNIARGMMFSVGCIRALVCHTNTCPAGVATTDPKLQKALSVEEKQHRVCNYVISL
REGLFNLAAAAGINSPIHFSKEHVVYRKEDGSIINIDNLIHQFVS

BLAST