GenomeNet

>bsu:BSU06740 no KO assigned | (RefSeq) yefB; hypothetical protein (A)
MYNEGVTSPSQLARKKNATDKWHGSSIRKILENPHYTGTLQQCREYRPSVTSKRRRSVNL
ENQIIIEKSHEPIIPLEDFLIVQEILITRKRRRPQAEVHLFTNTAVCKDCRRSMHFKKNR
KGYVCGSYNKHGLKACSDHYVSEIDLTDKVITNLNKIYLKFSKENYFKELSEKALKYKEK
IESKIIEINEKLNDKKRDKSNLVISLANGVISKEDYQLAINITNEDISNFETTLHQLSKD
LEFQKIEKEIIDFKKSLDKFMKEGTLTPEMLHLLVDEIEVHANGTIEINYRFREPTVPSA

BLAST