GenomeNet

>bsu:BSU06930 no KO assigned | (RefSeq) yesK; hypothetical protein (A)
MSFSKREAGDVWSILFVTGIVTACLFAGVSVLMRMRFPDKSRPEWMLAGLIVLGVFAIWY
SLVYVRGWEGAALGMLGFNVIFGAIAGYLIDKAIRRYRKR

BLAST