GenomeNet

>bsu:BSU06970 K02027 multiple sugar transport system substrate-binding protein | (RefSeq) yesO; ABC transporter substrate-binding protein (A)
MKKICYVLLSLVCVFLFSGCSAGEEASGKKEDVTLRIAWWGGQPRHDYTTKVIELYEKKN
PHVHIEAEFANWDDYWKKLAPMSAAGQLPDVIQMDTAYLAQYGKKNQLEDLTPYTKDGTI
DVSSIDENMLSGGKIDNKLYGFTLGVNVLSVIANEDLLKKAGVSINQENWTWEDYEKLAY
DLQEKAGVYGSNGMHPPDIFFPYYLRTKGERFYKEDGTGLAYQDDQLFVDYFERQLRLVK
AKTSPTPDESAQIKGMEDDFIVKGKSAITWNYSNQYLGFARLTDSPLSLYLPPEQMQEKA
LTLKPSMLFSIPKSSEHKKEAAKFINFFVNNEEANQLIKGERGVPVSDKVADAIKPKLNE
EETNIVEYVETASKNISKADPPEPVGSAEVIKLLKDTSDQILYQKVSPEKAAKTFRKKAN
EILERNN

BLAST