GenomeNet

>bsu:BSU06980 K02025 multiple sugar transport system permease protein | (RefSeq) yesP; ABC transporter permease (A)
MTGNGADAMKKSRSIRKDNLAGYAFISPFIIGFLCFTVIPMGASLFLSFTSYDLFTAPKW
IGLDNFKEMFTGDEKYWQSLKVTFTYVLAGVPLRLGFALFIAVILNNAAKGTAIYRTLFY
LPSIIGGSVAVAIMWRNIFGNDGVINALLFFVGIDQKILWYQNPTSALWTLILLSVWQFG
SSMLIFLAGLKNIPSSYLEAASVDGANRVQRFFKITLPILTPIIFFNLVMQTISAFMTFT
PAYIISKGEGGPLDGTLLYSLYLFQRAFNYFQMGYASAMAWVMLVIVGLITLILFKTSSY
WVHYESKEE

BLAST