GenomeNet

>bsu:BSU07030 no KO assigned | (RefSeq) yesU; hypothetical protein (A)
MYKEGACLYRNPLRSKSDVKDWRMEGGGQISFDDHSLHLSHVQDEAHFVFWCPETFPDGI
IVTWDFSPIEQPGLCMLFFAAAGIRGEDLFDPSLRKRTGTYPEYHSGDINALHLSYFRRK
YAEERAFRTCNLRKSRGFHLAAMGADPLPSPDDADSPYRMKLIKDKGYVHFSINGLPILE
WMDDGSTYGPVLTKGKIGFRQMAPMKAVYRDFAVHQAVRR

BLAST