GenomeNet

>bsu:BSU07120 K17320 putative aldouronate transport system permease protein | (RefSeq) lplC; ABC transporter permease LplC (A)
MAEIHTMHNTKAGRVFDVCNILFLGGVGAITILPFLYIIAGSFATEAELAQRSFFIFPKT
FTLDAYKYVFSTPTFLRSMGVSIFITVVGTAVQLFFTFTMAYPLAKRHVKGRNLLLNLVI
FSMLFSGGMIPTYLVVKSLGLLDTYWALILPMAINPFNLIIIKNFFQQLPRELEESAKID
GCSEIGVFWRIALPLSKPVIATFALFYAVGIWNDFFHALLYINDSAKWPLQMVLRQVTIL
SDLTATNGDTMQNAVPPEQGIKLAVIVIATLPILAVYPFLQKHFAKGMLIGSVKG

BLAST