GenomeNet

>bsu:BSU07200 K06890 uncharacterized protein | (RefSeq) yetJ; hypothetical protein (A)
MQATVHESKQSIMQRILTVFVFTLLIATVGLFIGQFVPVALMLPLSILEVAMIILAFWMR
RRKAVGYAFVYTFAFVSGITLFPIVSHYASIAGAYVVLEAFGSTFVIFAVLGTIGAKMKK
DLSFLWSFLLVAVLALAVVGIFNIFSPLNSAAMMAYSVIGTIVFSLYILYDLNQIKHRHI
TEDLIPVMALSLYLDFINLFINLLRFFGILSSDD

BLAST