GenomeNet

>bsu:BSU08440 K02016 iron complex transport system substrate-binding protein | (RefSeq) yfiY; siderophore-binding lipoprotein YfiY (A)
MKKHISMLFVFLMAVMVLSACNSSESSSNSEVSSSKTRTVKHAMGTSDNIPANPKRIVVL
TNEGTEALLALGIKPVGAVKSWKGDPWYDYLKDDMKGVKNVGLETEPNVEAIAELKPDLI
IGNKVRQEKIYDQLNAIAPTVFAESLAGNWKDNLTLYANAVNKADKGKEVIADFDKRVSD
LKNKLGDQTNKTVSVVRFLSGESRIYYTDSFPGIILDQLGFKRPEKQVELFKKQKDQFTF
STDSKESIPDMDADVLFYFTYKADNAKENEKWANQWTSSSLWKNLKAVKSGNAHEVDDVV
WTTAGGIKAANYLLDDIETYFLKTK

BLAST