GenomeNet

>bsu:BSU08580 no KO assigned | (RefSeq) yfhL; hypothetical protein (A)
MTGLVGGGLMIIAGILIKLFPPKSINSVYGYRTRRSMSDQRLWNEANRYSASLMILSGLV
IAGMGLLLGSNLFILQLILLIAACVITFMLTEKRLKIMTHSQGGDRSGRS

BLAST