GenomeNet

>bsu:BSU08650 K10780 enoyl-[acyl-carrier protein] reductase III [EC:1.3.1.104] | (RefSeq) fabL; enoyl-[acyl-carrier-protein] reductase [NADPH] FabL (A)
MEQNKCALVTGSSRGVGKAAAIRLAENGYNIVINYARSKKAALETAEEIEKLGVKVLVVK
ANVGQPAKIKEMFQQIDETFGRLDVFVNNAASGVLRPVMELEETHWDWTMNINAKALLFC
AQEAAKLMEKNGGGHIVSISSLGSIRYLENYTTVGVSKAALEALTRYLAVELSPKQIIVN
AVSGGAIDTDALKHFPNREDLLEDARQNTPAGRMVEIKDMVDTVEFLVSSKADMIRGQTI
IVDGGRSLLV

BLAST