GenomeNet

>bsu:BSU08980 K09786 uncharacterized protein | (RefSeq) yhbH; stress response UPF0229 protein YhbH (A)
MSQNDSGHFLISEENWSLHRKGFDDQQRHQKKVQEAIKNNLPDLVTEESIIMSNGKDVVK
IPIRSLDEYKIRYNYDKNKHVGQGDGESQVGDVVARDGSDKKQGPGKGQGAGDQAGEDYY
EAEVSLMDLEEALFKELELPNLQQKERDNIIHTDIEFNDIRKTGLTGNIDKKRTMMSAFK
RNAMSGKPSFYPIYPEDLKYKTWNDITKPESKAVVLAMMDTSGSMGVWEKYMARSFFFWM
TRFLRTKYETVEIEFIAHHTEARVVSEEDFFSKGESGGTICSSVYRKSLELIDEKYNPAR
YNIYPFHFSDGDNLTSDNARCVKLVNDIMKKANLFCYGEVNQYNRHSTLMSAYKNVKDEK
FKYYILKQKSDVFQALKNFFRNEESGVSHQFS

BLAST