GenomeNet

>bsu:BSU09200 K07284 sortase A [EC:3.4.22.70] | (RefSeq) yhcS; hypothetical protein (A)
MKKVIPLFIIAAGLVIAGYGGFKLIDTNTKTEQTLKEAKLAAKKPQEASGTKNSTDQAKN
KASFKPETGQASGILEIPKINAELPIVEGTDADDLEKGVGHYKDSYYPDENGQIVLSGHR
DTVFRRTGELEKGDQLRLLLSYGEFTYEIVKTKIVDKDDTSIITLQHEKEELILTTCYPF
SYVGNAPKRYIIYGKRVT

BLAST