GenomeNet

>bsu:BSU09270 K02443 glycerol uptake operon antiterminator | (RefSeq) glpP; glycerol uptake operon antiterminator regulatory protein (A)
MMSFHNQPILPAIRNMKQFDEFLNSSFSYGVILDIHLGQLKGVIKEAQKHGKNMMVHVDL
IQGIKHDEYGAEFICQDIKPAGIISTRSNVIAKAKQKKIYAIQRLFLLDTSAMEKSMEFI
GKHKPDFIEVLPGIVPSLIQEIKEKTGIPIFAGGFIRTEEDVEQALKAGAVAVTTSNTKL
WKKYENFLTESD

BLAST