GenomeNet

>bsu:BSU09360 no KO assigned | (RefSeq) yhdC; hypothetical protein (A)
MKSLPYTIALLFCGLIIVSMAAKGHSTDTDESVQKWEQLAWSKIQDEYKGASFSDYAYMG
RTEVNDQQTKDVFRVTVRQKDDTFSVRAEVYFHPVTNHMISINVFRL

BLAST