GenomeNet

>bsu:BSU09590 no KO assigned | (RefSeq) yhdT; hypothetical protein (A)
MDDIDSLILIGVLIALTAFFVASEFAIVRVRRSRIDQLITEGNKRAILARRVITDLDEYL
SASQLGITLTSIGLGVLGEPAFERLLHPLFEPLGLPDSVSHAVSFAVAYGLITFLHVVVG
ELAPKTVAIQKAEQLTLLIAGPLRLFYLLLFPFIWILNGSARLLCGMFGLKPASEHDGSH
SEEELRMLLSESLKNGEINPSEYKYVNKIFEFDNRIAKEIMIPRKEMAAVSTEMTMAEML
EVMLKEKYTRWPVTDGDKDSVLGLVNTKHLFSDLLFMTEEERMKMTIHPYVRPVIEVIET
IPVHDLLIKMQRERIHMAILSDEYGGTSGLVTTEDILEEIVGEIRDEFDEDEQPLIQKLG
DGHYVMDGKVRIDQVNSLLGASIQEDVDTIGGLILKENIDIEAGESIRIGSYTIKVLKMD
GRLIKQIDIKEEAGNTTGITAHHKLPLPEPVMLNSATLSEK

BLAST