GenomeNet

>bsu:BSU09650 K12410 NAD-dependent deacetylase [EC:2.3.1.286] | (RefSeq) yhdZ; NAD-dependent protein deacetylase (A)
METFKSILHEAQRIVVLTGAGMSTESGIPDFRSAGGIWTEDASRMEAMSLDYFLSYPRLF
WPKFKELFQMKMSGSFEPNEGHLLLAELEKQGKQVDIFTQNIDGLHKKAGSRHVYELHGS
IQTAACPACGARYDLPHLLEREVPECTAAGNNGDICGTVLKTDVVLFGDAVMHFDTLYEK
LDQADLLLVIGTSLEVAPARFVPEDASLIPGMKKVIINLEPTYCDSLFDMVIHQKIGEFA
RSLGMKK

BLAST