GenomeNet

>bsu:BSU09750 K06419 small acid-soluble spore protein B (major beta-type SASP) | (RefSeq) sspB; small acid-soluble spore protein B (A)
MANQNSSNDLLVPGAAQAIDQMKLEIASEFGVNLGADTTSRANGSVGGEITKRLVSFAQQ
QMGGRVQ

BLAST