GenomeNet

>bsu:BSU09790 no KO assigned | (RefSeq) yheB; hypothetical protein (A)
MGIAGTFIFMIVIGAAIGAVTNHLAIQMLFRPYKAYYLFGKRVPFTPGLIPRRRDELAKQ
MGLMVVNHLLTPEGIKKRLVSDAAKTQALRVGEQLIQKLSLSEVTVKEALEKAGMKRPEK
AADAWISSWTDDKLHELFRQYGDQSLKELVPIEVQEKLEEKIPMISGYILSRSVRYFESD
EGKIRLGNMIDDFLKERGMLGSMVQLFLGNSSLADRVLPELLKFLRNEETNKLLSDLLKN
EWGKLREYTFNEADEKWNAKALIFSLKRRVLQAFSTAPFFNNTIGTLTVRYESELTQQML
PALLDKLLEGISSNLESVLKRLRLEEIVKEQVDQFPVERLEEMVLSISKKEFKMITYLGG
LLGGIIGAIQALFVILF

BLAST