GenomeNet

>bsu:BSU09810 no KO assigned | (RefSeq) yhaZ; hypothetical protein (A)
MADLKEIYNEELISQLIHHVRSSYPDFNKNRFLDTLRLEDWPELTLKERMRRVTVSLYET
LPKQYVEALTILRDTAPHFKGLSGILFPDYVEQYGLAHWEESIKALESFTQYSTSEFAVR
PFLLLDQEKMIAQLLAWSEHKNEHVRRLASEGSRPRLPWGKSIPALKSDPSPVLPILEKL
MQDESLYVRKSVANNLNDISKTHPHLLRKVADQWYGTHPHTDWIIKHAYRTLLKKGDKQA
LALFGYENADSIQLHDLTCQPKRIVIGESLEFSFYIHSDRDQKVRIEYAIDFVKARGQRH
QKVFKITETNIRKNETKSYTRIQSFKDLTTRKHYKGIHTLSVIINGEVKDSLDFQVC

BLAST