GenomeNet

>bsu:BSU09860 K07228 TrkA domain protein | (RefSeq) khtT; K(+)/H(+) antiporter subunit KhtT (A)
MNIKENDLPGIGKKFEIETRSHEKMTIIIHDDGRREIYRFNDRDPDELLSNISLDDSEAR
QIAAILGGMVYKPQALESIEMAFSDLIIEWFKVEKGAKSIGRTLGELDVRQNYDVTVIAI
IKHNQEKLLNPGADSIIEENDTLVLSGERKHLKKLIHDFLSGEGV

BLAST