GenomeNet

>bsu:BSU09870 no KO assigned | (RefSeq) khtS; hypothetical protein (A)
MRREERNMDKLLISFLLSLFMVYFPPSDVVLPSQFEASTDSYVPMSSYPQETQSAKTPSP
GSMHPAELIKEYSPLAQSVRQLSVKPLDEPLINRLEKALAVPVKYQSNYLRI

BLAST