GenomeNet

>bsu:BSU09910 K03547 DNA repair protein SbcD/Mre11 | (RefSeq) yhaO; metallophosphoesterase (A)
MLTDLTFIHAADLHLDSPFYGISHLPEPIFARIKESTFASVRHMIDAAVREHVDFILLAG
DLFDEANRSLKAQLFLKKQFERLRECGISVYVIFGNHDHLGGEWTPIEWPENVHIFSSAV
PEEKSFFKEGRRIASIYGFSYQARALMENQAARYRRSTDAPFHIGMLHGTLSGSEGHDPY
CPFTHDDLVKSGMDYWALGHIHKRQVLSAEHPAVIYPGNTQARHIKETGDKGYYLVHVTN
GDISYEFQRAHDVLWEKAAVDVTEAKNMTALFQMVEDTFSKLRKKGSPVCVRLVLQGTAP
EWLLEAPKGTLDEFLEALQEQEAEEERFVWPLRLDDETENEANLTNLDPFFGGLFEDIDR
SDLSDVLEGLERHPVYRRHADRFSQEEVKEIKEQAQIILKRQLKVLDT

BLAST