GenomeNet

>bsu:BSU10030 K02503 histidine triad (HIT) family protein | (RefSeq) hinT; protein hit (A)
MHCAENCIFCKIIAGDIPSAKVYEDEHVLAFLDISQVTKGHTLVIPKTHIENVYEFTDEL
AKQYFHAVPKIARAIRDEFEPIGLNTLNNNGEKAGQSVFHYHMHIIPRYGKGDGFGAVWK
THADDYKPEDLQNISSSIAKRLASS

BLAST