GenomeNet

>bsu:BSU10090 no KO assigned | (RefSeq) yhgB; hypothetical protein (A)
MKHTCPVCGFKDWLNRHMIMKAIILMKSARAAVFSSDLMSTRCSTRITHIEPSESIIAYR
KNWLAEGCVIFSPECFPKHLQKANRGLRHHLIEQLKQINVHLPS

BLAST