GenomeNet

>bsu:BSU10210 no KO assigned | (RefSeq) yhfF; hypothetical protein (A)
MKIYKLKSTFGWEGDDGLGEQLIQQILAGEKSATCAPKSLYSKDELRDVYQTAGQLVTVY
DKHDNPRCNIKVTDVFETTFGAPDMRLVKGEGNGDRIEEFQEDHRMAWAELIKSGELELN
EDTVLITELFVLVKD

BLAST