GenomeNet

>bsu:BSU10230 no KO assigned | (RefSeq) yhfH; hypothetical protein (A)
MVMLGKITEFFRNLPSKKCAECGKKIEEQHECYGNICNDCIKVNDL

BLAST