GenomeNet

>bsu:BSU10440 no KO assigned | (RefSeq) yhjA; hypothetical protein (A)
MKKAAAVLLSLGLVFGFSYGAGHVAEAKTKVKVYKNCKELNKVYKGGVARTSKVKNKGGK
TKYKPYVSKALYDANKNKDRDKDLIACER

BLAST