GenomeNet

>bsu:BSU10630 K16898 ATP-dependent helicase/nuclease subunit A [EC:3.1.-.- 3.6.4.12] | (RefSeq) addA; ATP-dependent helicase/nuclease subunit A (A)
MNIPKPADSTWTDDQWNAIVSTGQDILVAAAAGSGKTAVLVERMIRKITAEENPIDVDRL
LVVTFTNASAAEMKHRIAEALEKELVQRPGSLHIRRQLSLLNRASISTLHSFCLQVLKKY
YYLIDLDPGFRIADQTEGELIGDEVLDELFEDEYAKGEKAFFELVDRYTTDRHDLDLQFL
VKQVYEYSRSHPNPEAWLESFVHLYDVSEKSAIEELPFYQYVKEDIAMVLNGAKEKLLRA
LELTKAPGGPAPRADNFLDDLAQIDELIQHQDDFSELYKRVPAVSFKRAKAVKGDEFDPA
LLDEATDLRNGAKKLLEKLKTDYFTRSPEQHLKSLAEMKPVIETLVQLVISYGKRFEAAK
QEKSIIDFSDLEHYCLAILTAENDKGEREPSEAARFYQEQFHEVLVDEYQDTNLVQESIL
QLVTSGPEETGNLFMVGDVKQSIYRFRLAEPLLFLSKYKRFTESGEGTGRKIDLNKNFRS
RADILDSTNFLFKQLMGGKIGEVDYDEQAELKLGAAYPDNDETETELLLIDNAEDTDASE
EAEELETVQFEAKAIAKEIRKLISSPFKVYDGKKKTHRNIQYRDIVILLRSMPWAPQIME
ELRAQGIPVYANLTSGYFEAVEVAVALSVLKVIDNPYQDIPLASVLRSPIVGADENELSL
IRLENKKAPYYEAMKDYLAAGDRSDELYQKLNTFYGHLQKWRAFSKNHSVSELIWEVYRD
TKYMDYVGGMPGGKQRQANLRVLYDRARQYESTAFRGLFRFLRFIERMQERGDDLGTARA
LSEQEDVVRLMTIHSSKGLEFPVVFVAGLGRNFNMMDLNKSYLLDKELGFGTKYIHPQLR
ISYPTLPLIAMKKKMRRELLSEELRVLYVALTRAKEKLFLIGSCKDHQKQLAKWQASASQ
TDWLLPEFDRYQARTYLDFIGPALARHRDLGDLAGVPAHADISGHPARFAVQMIHSYDLL
DDDLEERMEEKSERLEAIRRGEPVPGSFAFDEKAREQLSWTYPHQEVTQIRTKQSVSEIK
RKREYEDEYSGRAPVKPADGSILYRRPAFMMKKGLTAAEKGTAMHTVMQHIPLSHVPSIE
EAEQTVHRLYEKELLTEEQKDAIDIEEIVQFFHTEIGGQLIGAKWKDREIPFSLALPAKE
IYPDAHEADEPLLVQGIIDCLYETEDGLYLLDYKSDRIEGKFQHGFEGAAPILKKRYETQ
IQLYTKAVEQIAKTKVKGCALYFFDGGHILTL

BLAST