GenomeNet

>bsu:BSU10740 no KO assigned | (RefSeq) yisJ; inner spore coat protein H-like protein (A)
MERVHLFFHREQLKRKGTAKGLFVTDRSVSPILLTQRDRAEKASYEISWEKSLLGERTLF
LNAEQDDPSLMRRRLAYCFFDQIGVPAPVASYSFLTINGQPEGIYLNIKNHQPAGKRSYG
VKTADPRVPLSLFNNDSSAFLHEFFILIRTAGDDELAERIKLYLDVKLFFLWLIGNTCTN
QGFYYTFCLNESGRLYVSPMETRSLAVQEWYEEDPLLTKGKTLSSRLLSIPAFRSQYHTL
MKNVLKRSFTIERLSPLINEWHLDICQSAADDPFIKKSPFQIEKEQTNILREIEERQDFL
QAHLARL

BLAST