GenomeNet

>bsu:BSU10750 no KO assigned | (RefSeq) yisK; hypothetical protein (A)
MKFATGELYNRMFVGLIIDDEKIMDLQKAEKKLFELETIPGSLIECIAEGDKFVAHARQL
AEWAKKPNDELGSFMYSLSEVKLHAPIPKPSKNIICIGKNYRDHAIEMGSEADIPEHPMV
FTKSPVTVTGHGDIVKSHEEVTSQLDYEGELAVVIGKSGTRISKEDAYDHVFGYTIVNDI
TARDLQKRHKQFFIGKSLDTTCPMGPVLVHKSSIQEPERLKVETRVNGELRQSGSASDMI
FSIPELIETLSKGMTLEAGDIIATGTPSGVGKGFTPPKFLRSGDKIDITIDPIGTLSNQI
G

BLAST