GenomeNet

>bsu:BSU10780 no KO assigned | (RefSeq) yisN; hypothetical protein (A)
MKKKETAWMKRKQLLYTEERKWEYGTILIEDGICLIENGEGDILLADSLQHSPIWIHHKG
KWEQAGFQDKLVLACGAENISLSGGERIRYEKSVKRPLMALLDSLDDETFLAFLQHLHSF
GLSVFDCVFSYNKGVFSNTSAGQGVSFYHFSNDTAQCAMQHHYNYSSEGTGDRFEWTASN
GKRSIMYTAVQRGRK

BLAST