GenomeNet

>bsu:BSU10890 no KO assigned | (RefSeq) yisX; hypothetical protein (A)
MNKIAIQKPNIPENLQTADFHDAVTQDDVISMHLFEDCTICGEDIERLCVEKTVFRNVVF
IDVSFRHIELTDVIFEKCDLSNADFSGAVIHRTSVKQSKMVGMNVAEATLRNVSFEECHG
HFSSFSYSNMKQVRFDHCALMQSECSDTVLQQTHFDGCELEGASFTGTSLQNMDISTCRF
EQLHVSLDKLKGCKIAPEHAIAFARALGAVIV

BLAST