GenomeNet

>bsu:BSU10910 K00860 adenylylsulfate kinase [EC:2.7.1.25] | (RefSeq) yisZ; adenylyl-sulfate kinase (A)
MTHNPNIIWHPAAISKSDRQSLNGHKSCVLWFTGLSGSGKSVLANAVDEKLYRKGIQSYV
LDGDNIRHGLNKDLGFQTGDRIENIRRIGEVAKLFVDSGQMILTAFISPFREDRDMVRAL
FPKGEFFEIYVKCPLHVCEQRDPKGLYKKARNGEIKHFTGIDSPYEAPLSPDFIIESDQT
SISDGADLIINALQNRGII

BLAST