GenomeNet

>bsu:BSU11040 no KO assigned | (RefSeq) yitM; hypothetical protein (A)
MKKAFLVFLSVVLVTTVFLVKQQESVAQAKQLEYSGEEIFKGFVFAQGEVGKQLPEVFNK
AMTDKLNTKQAKAFANQVVADIKKEDADFFDNLKKAVYSKDALKVDELLKKAGQIVEEKV
EAAKEIAASKDDTSRVQAELVNTVDTANYFYYVSYVAAAGALILIILAIDITPIAISDNV
DREMAIRTLVDELN

BLAST