GenomeNet

>bsu:BSU11070 no KO assigned | (RefSeq) yitP; hypothetical protein (A)
MQKSISFFVIFSILWGSLFLFSIIGSLGTTPIPLTKDSKFLMSSILPQGWGFFSKNPRDT
AIGLYEAENASAKVRWPNMRADNLFGLYRYGRSQGVEMGVIYSQVGKEQWTACKEKDLGA
CKSKAKTVQLKTPAPRPLLCGSYYLTKEDIVPWSYSKYTPSSYQVKSIVKVVISCSKT

BLAST