GenomeNet

>bsu:BSU11090 no KO assigned | (RefSeq) yitR; hypothetical protein (A)
MEISINYLLIVIALLFFVVAYFVGIKKQTWMLAGFNEARIRDKDRLARIAGYFFLNSGLF
ILLNSFISFQGQEQLIPPLILAYGAGVIIYVNKKLVE

BLAST