GenomeNet

>bsu:BSU11200 K00620 glutamate N-acetyltransferase / amino-acid N-acetyltransferase [EC:2.3.1.35 2.3.1.1] | (RefSeq) argJ; arginine biosynthesis bifunctional protein ArgJ (A)
MIQLSEDQIVKVTGDVSSPKGFQAKGVHCGLRYSKKDLGVIISETPAVSAAVYTQSHFQA
APIKVTQDSLKHGPTLKAVIVNSAIANACTGEQGLKDAYTMRESFASQLGIEPELVAVSS
TGVIGEHLDMEKIHAGIELLKETPAGSGDFEEAILTTDTVIKQTCYELAIGGKTVTIGGA
AKGSGMIHPNMATMLGFVTTDAAIEEKALQKALREITDVSFNQITVDGETSTNDMVLVMA
NGCAENECLTEDHPDWPVFKKALLLTCEDLAKEIARDGEGATKLIEAQVQGAKNNLDANV
IAKKIVGSNLVKTAVYGTDANWGRIIGAIGHSAAQVTAEEVEVYLGGQCLFKNNEPQPFS
ESIAKEYLEGDEITIVIKMAEGDGNGRAWGCDLTYDYIKINASYRT

BLAST