GenomeNet

>bsu:BSU11210 K00930 acetylglutamate kinase [EC:2.7.2.8] | (RefSeq) argB; acetylglutamate kinase (A)
MKKTIVFKCGGSVIRELSEEFYQNLKELRASGWKLAIVHGGGPEITNMLKRLNIKTEFSG
GQRKTTKPVLEVAEMVLSGSVNKFFVAELAKHGLRAAGISGKDGGLLEADYLDPETYGEV
GEIKKVDASMVNALMENGIIPVIAPLSMTSDCKTLNVNADLAASAVAGALEADKLMFVTD
VDGIMKEKQRLDVLTPKEIQMLIKQEVITGGMIPKVNSALSALSDQVSEVMIVNGKGSFF
AEQTFQGTKIVKAKEAVS

BLAST