GenomeNet

>bsu:BSU11260 no KO assigned | (RefSeq) yjzC; hypothetical protein (A)
MGQQHQFRPGQKAPNNGVYVEIGETGSMVKNPQKVHLSAGEMFPETSNHNRLWTYKRKP

BLAST