GenomeNet

>bsu:BSU11280 no KO assigned | (RefSeq) yjaU; hypothetical protein (A)
MGITERYFQLGTEHNVIHLPYRPNGFGIFILGDRTHFVGHDSSFWQQHYGRNQLLSMLMN
EGYTLFNSNLFGRHWGAEKAVTYAKQLIHSVLKQEILNPKIHILAEGMGALVADELLRFS
PDHIRSAAMLNPCLDLQAHYESEKENKFFYKQFLKEVSKSYGISEKEAEAIRYKTIQSYP
SGVPVHIWQRMTGAPYPYSVHAEVFKEKQQKQGSPVDMTFHLFEHPSRIYASICKFFHSH
EKEL

BLAST