GenomeNet

>bsu:BSU11400 K02034 peptide/nickel transport system permease protein | (RefSeq) appC; oligopeptide transport system permease protein AppC (A)
MSELQTTPSPEIRLKENISKKPETMTKIFWEKFSKNKLAILGAVILFIIIMSAVFAPLIA
PYPQEQQSLLDKYKAPGLEHLMGTDKFGRDIFSRILYGARVSLLVGFASVVGSILIGTVL
GALAGYFRGIVDAVIMRVVDIVLSIPDIFLLITLVTIFKPGVDKLILIFCLTGWTTTARL
VRGEFLSLRSREYVLAAKTIGTKTHKIIFSHILPNALGPIIVSATLKVGSVILAESALSY
LGFGIQPPIASWGNMLQDAQNFTVMIQAWWYPLFPGLFILMTVLCFNFVGDGLRDALDPK
NIK

BLAST