GenomeNet

>bsu:BSU11590 no KO assigned | (RefSeq) yjbL; hypothetical protein (A)
MQNRIEILNATLSDDQLRLACQTEGNEAERKPSGQMLVDSDHFAFVYILELADSFEYVII
KEHVWPELKQAHAQKIPVVLEAGDQTIELAGLHEELEYLLENIKDNANYGEEMEEKVKRV
FL

BLAST