GenomeNet

>bsu:BSU11740 K06344 spore coat protein Z | (RefSeq) cotZ; spore coat protein Z (A)
MSQKTSSCVREAVENIEDLQNAVEEDCPTGCHSKLLSVSHSLGDTVPFAIFTSKSTPLVA
FGNVGELDNGPCFNTVFFRVERVHGSCATLSLLIAFDEHKHILDFTDKDTVCEVFRLEKT
NYCIEVDLDCFCAINCLNPRLINRTHHH

BLAST