GenomeNet

>bsu:BSU11970 no KO assigned | (RefSeq) yjcS; hypothetical protein (A)
MKSHKMMGGGISMHYITACLKIISDKDLNEIMKEFKKLEEETNKEEGCITFHAYPLEPSE
RKIMLWEIWENEEAVKIHFTKKHTIDVQKQELTEVEWLMKSNVND

BLAST