GenomeNet

>bsu:BSU12010 K02770 fructose PTS system EIIBC or EIIC component [EC:2.7.1.202] | (RefSeq) manP; PTS system-mannose-specific transporter subunit EIIBCA (A)
MKLLAITSCPNGIAHTYMAAENLQKAADRLGVSIKVETQGGIGVENKLTEEEIREADAII
IAADRSVNKDRFIGKKLLSVGVQDGIRKPEELIQKALNGDIPVYRSATKSESGNHQEKKQ
NPIYRHLMNGVSFMVPFIVVGGLLIAVALTLGGEKTPKGLVIPDDSFWKTIEQIGSASFS
FMIPILAGYIAYSIADKPGLVPGMIGGYIAATGSFYDSASGAGFLGGIIAGFLAGYAALW
IKKLKVPKAIQPIMPIIIIPVFASLIVGLAFVFLIGAPVAQIFASLTVWLAGMKGSSSIL
LALILGAMISFDMGGPVNKVAFLFGSAMIGEGNYEIMGPIAVAICIPPIGLGIATFLGKR
KFEASQREMGKAAFTMGLFGITEGAIPFAAQDPLRVIPSIMAGSMTGSVIAMIGNVGDRV
AHGGPIVAVLGAVDHVLMFFIAVIAGSLVTALFVNVLKKDITASPVLSETAPTSAPSEAA
AANEIKQPIQSQKAEMSEFKKLTDIISPELIEPNLSGETSDDIIDELIQKLSRRGALLSE
SGFKQAILNREQQGTTAIGMNIAIPHGKSEAVREPSVAFGIKRSGVDWNSLDGSEAKLIF
MIAVPKESGGNQHLKILQMLSRKLMDDNYRERLLSVQTTEEAYKLLEEIE

BLAST