GenomeNet

>bsu:BSU12200 no KO assigned | (RefSeq) yjiA; hypothetical protein (A)
MAAQTDYKKQVVGILLSLAFVLFVFSFSERHEKPLVEGKKQENWHTVVDKASVKIYGSRL
VEENKLKQKLGHKQADSILTLLKLANEKHITL

BLAST