GenomeNet

>bsu:BSU12520 no KO assigned | (RefSeq) xkdB; phage-like element PBSX protein XkdB (A)
MKNDKSYPFPTYSGLLNSEHYDKIGPALWLFLWFISSTTKEIEKDGVSWGIVLGHKPLKA
REMAAVFGVSEKTVRRWLELLENHDYIKAVRAPYGLMISVKHSKKFSFRSDNTVHGSLKE
RPFSPQTPDTNDRTDIDKTNKYTAADDAVDHIAKRFTQLRSAQEGRTVYPSSRDYQAIAR
IVAIGVPVTQTIKWLEECFQAFENRRTAASETIKAFRYCSKFIEDRFFAQQAKKNAAIQH
ERMKKHDKTNNRTDFGRAEKRETSITGGQTGRIRRKQV

BLAST