GenomeNet

>bsu:BSU12630 no KO assigned | (RefSeq) xkdI; phage-like element PBSX protein XkdI (A)
MKIAGLKQLNTALKEAASGGFSRQASRWLEECGQDFLEIVQSELISTQTIDTEKLLSSFE
KGAEDNLWIVQSGGLSLEVGTQLDYASFLNDGHWTSKQDVRWVPGRFQGSRFIYDPAAST
GMALKRKWIPGTGYWDHALLLYEQLFEKSLESKLRQWLKKL

BLAST