GenomeNet

>bsu:BSU12950 K16202 dipeptide transport system ATP-binding protein | (RefSeq) dppD; dipeptide transport ATP-binding protein DppD (A)
MEKVLSVQNLHVSFTTYGGTVQAVRGVSFDLYKGETFAIVGESGCGKSVTSQSIMGLLPP
YSAKVTDGRILFKNKDLCRLSDKEMRGIRGADISMIFQDPMTALNPTLTVGDQLGEALLR
HKKMSKKAARKEVLSMLSLVGIPDPGERLKQYPHQFSGGMRQRIVIAMALICEPDILIAD
EPTTALDVTIQAQILELFKEIQRKTDVSVILITHDLGVVAQVADRVAVMYAGKMAEIGTR
KDIFYQPQHPYTKGLLGSVPRLDLNGAELTPIDGTPPDLFSPPPGCPFAARCPNRMVVCD
RVYPGQTIRSDSHTVNCWLQDQRAEHAVLSGDAKD

BLAST